SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017240 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017240
Domain Number 1 Region: 281-406
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-22
Family C-type lectin domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017240   Gene: ENSNLEG00000014199   Transcript: ENSNLET00000018105
Sequence length 409
Comment pep:known_by_projection supercontig:Nleu1.0:GL397282.1:30106373:30129975:-1 gene:ENSNLEG00000014199 transcript:ENSNLET00000018105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAWEAAPGGQVGAELPMEPVGSLVPGLEQPQVPAKAPQPEGPESSRSPAGAVEKAAGA
GLEPSSKKKLPSPRPGSPRVPPLSLGYGVCPEPPSPVPALVKLPRNGEAPGAEPAPGAWA
PMELQVDVRVKPVGAAGGSRTPSPRPSTRFLTVPVPESPAFSRHADPAHQLLRRAQSLGG
TWGRGSPLAAARTESGCDAEGRASPAEGSAGSPGSPTCCRCKELGLEKEDAALLPCAGLD
GDKKLPRAVTLTGLPMYVKSLCWALAFMAVLLAVSGVVIVVLASRAGARCQQCPPGWVLS
EEHCYYFSAEAQAWEASQAFCSAYHATLPLLSHTQDFLGRYPVSRHSWVGAWRGPQGWHW
INEAPLLPQLLPEDGEDNLDINCGALEEGMLVAANCSTLRPWVCAKGTQ
Download sequence
Identical sequences G1RVG3
ENSNLEP00000017240 XP_003261461.1.23891 ENSNLEP00000017240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]