SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017247 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017247
Domain Number 1 Region: 77-214
Classification Level Classification E-value
Superfamily C-type lectin-like 1.07e-34
Family C-type lectin domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017247   Gene: ENSNLEG00000014203   Transcript: ENSNLET00000018112
Sequence length 215
Comment pep:known_by_projection supercontig:Nleu1.0:GL397282.1:30169445:30190462:1 gene:ENSNLEG00000014203 transcript:ENSNLET00000018112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAREPPSRARPPPPPLAARPVPVPAAPRPRSPAEAEARGPEGLLRRSGSGYEGSTSWK
AALEDTTTRLLLGAIAVLLFAILVVMSILASKGCIKCEAPCPEDWLLYGRKCYFFSEEPR
DWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTF
TIAGPGECVFVEPTRLVSTECLMTRPWVCSKMAYT
Download sequence
Identical sequences G1RVH0
ENSNLEP00000017247 ENSNLEP00000017247 XP_003261462.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]