SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017259 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017259
Domain Number 1 Region: 538-730
Classification Level Classification E-value
Superfamily Fibronectin type III 1.07e-48
Family Fibronectin type III 0.00000165
Further Details:      
 
Domain Number 2 Region: 856-1053
Classification Level Classification E-value
Superfamily Fibronectin type III 5.24e-35
Family Fibronectin type III 0.00000133
Further Details:      
 
Domain Number 3 Region: 250-343
Classification Level Classification E-value
Superfamily Immunoglobulin 3.33e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 341-437
Classification Level Classification E-value
Superfamily Immunoglobulin 9.83e-22
Family I set domains 0.0076
Further Details:      
 
Domain Number 5 Region: 434-534
Classification Level Classification E-value
Superfamily Fibronectin type III 2.49e-21
Family Fibronectin type III 0.00000127
Further Details:      
 
Domain Number 6 Region: 722-828
Classification Level Classification E-value
Superfamily Fibronectin type III 2.15e-19
Family Fibronectin type III 0.000000698
Further Details:      
 
Domain Number 7 Region: 141-241
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-18
Family I set domains 0.025
Further Details:      
 
Domain Number 8 Region: 55-158
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-17
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017259   Gene: ENSNLEG00000014106   Transcript: ENSNLET00000018124
Sequence length 1461
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:16889961:17154691:1 gene:ENSNLEG00000014106 transcript:ENSNLET00000018124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERGARRLLSTSSFWLYCLLLLGRRAPGAAVARSGSAPQSPGASIQTFTPFYFLVEPV
DTLSVRGSSVILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLPDGSLFISNVVHSKHN
KPDEGYYQCVATVESLGTIVSRTARLTVAGLPRFTSQPEPSSVYAGDNAVLNCEVNADLV
PFVRWEQNRQPLLLDDRVIKLPSGMLVISNATEGDGGLYRCVVESGGPPKYSDEVELKVL
PDPEVQSDLVFLKQPSPLVRVIGQHVVLPCVASGLPTPTIKWMKNEEALDTESSERLVLL
AGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNIYAHESMDIVF
ECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQ
AGAQLIILEHAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKE
GIARERVENTSRPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPEVQLPG
PAPNLRAYAASPTSITVMWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLK
KYTEYSFRVVAYNKHGPGVSTPDVAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPA
TQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPA
TDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSP
HAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFV
INAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIP
ANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKD
VTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQ
ELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKADSSDKMPNDQASGSGGKGSRLPDLGS
DYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVIIAVFCTRRTTSHQKKKRA
ACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPV
DNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDN
PHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTC
CTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPTYDPALP
STPLLSQQALNHHIHSVKTASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDE
LTKEMAHLEGLMKDLNAITTA
Download sequence
Identical sequences G1RVI2
XP_003267233.1.23891 ENSNLEP00000017259 ENSNLEP00000017259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]