SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017269 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017269
Domain Number 1 Region: 723-1038
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000012
Further Details:      
 
Domain Number 2 Region: 996-1296
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.49e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000915
Further Details:      
 
Domain Number 3 Region: 229-426
Classification Level Classification E-value
Superfamily Fibronectin type III 3.47e-25
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 126-257
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000116
Family Fibronectin type III 0.007
Further Details:      
 
Domain Number 5 Region: 32-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000477
Family I set domains 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017269
Domain Number - Region: 443-555
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0354
Family Fibronectin type III 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017269   Gene: ENSNLEG00000014202   Transcript: ENSNLET00000018134
Sequence length 1298
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:19708887:19996915:-1 gene:ENSNLEG00000014202 transcript:ENSNLET00000018134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVIFEAEVSGGRTGYIAIDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAV
HNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFA
QLIVREPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVN
APTYKLWHLDPDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQAR
RIAVDWESLGYNITRCHTFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVS
LKMILTNPEGRKESEETIIQTDEDVPGPVPVKSLQGTSFENKIFLNWKEPLDPNGIITQY
EISYSSIRSFDPAVPVAGPPQTVSNLWNSTHHVFMHLHPGTTYQFFIRASTVKGFGPATA
INVTTNISAPTLPDYEGVDASLNETATTITVLLRPAQAKGAPISAYQIVVEELHPHRTKR
EAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGYWNPPLAPR
KGYNIYFQAMSSVEKETKTQCVRIATKAAATEEPEVIPDPAKQTDRVVKIAGISAGILVF
ILLLLVVILIVKKSKLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMD
QHNFSPRLPNDPLVPTAVLGKMPDENHSATAESSRLLDVPRYLCEGTESPYQTGQLHPAI
RVADLLQHINLMKTSDSYGFKEEYESFFEGQSASWDVAKKDQNRAKNRYGNIIAYDHSRV
ILQPVEDDPSSDYINANYIDIWLYRDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSACI
VMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVK
QFHFTGWPDHGVPYHATGLLSFIRRVKLSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDM
AEREGVVDIYNCVKALRSRRINMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDM
IRIDSQTNSSHLKDEFQTLNSVTPRLQAEDCSIACLPRNHDKNRFMDMLPPDRCLPFLIT
IDGESSNYINAALMDSYRQPAAFIVTQYPLPNTVKDFWRLVYDYGCTSIVMLNEVDLSQG
CPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNLTRPQEGYLMVQQFQYLGWASH
REVPGSKRSFLKLILQVEKWQEECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQNV
VDVFHAVKTLRNSKPNMVEAPEQYRFCYDVALEYLESS
Download sequence
Identical sequences ENSNLEP00000017269 ENSNLEP00000017269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]