SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017302 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017302
Domain Number 1 Region: 355-637
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.09e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000099
Further Details:      
 
Domain Number 2 Region: 178-354
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.8e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000869
Further Details:      
 
Domain Number 3 Region: 639-746
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.01e-27
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 4 Region: 144-176
Classification Level Classification E-value
Superfamily TGS-like 0.0000589
Family TGS domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017302   Gene: ENSNLEG00000014187   Transcript: ENSNLET00000018167
Sequence length 756
Comment pep:known_by_projection supercontig:Nleu1.0:GL397369.1:4470735:4498035:1 gene:ENSNLEG00000014187 transcript:ENSNLET00000018167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEEKASSPSGKMGGEEKPVGAGEEKRKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEM
YNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYLIACGISHTASCINLSS
LASLLASVAIPSSGMPWPPLFFLQGLADNTVIAKVNNVVWDLDRPLEEDSTLELLKFEDE
EAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGGVSSNDFSSLEALCK
KIIKEKQAFERLEVKKETLLAMFKYNKFKCRILNEKVNTPTTTVYRCGPLIDLCRGPHVR
HTGKIKALKIHKNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKLQEEAKNRDHRKIG
RDQELYFFHELSPGSCFFLPKGAYIYNALIEFIRSEYRKRGFQEVVTPNIFNSRLWMTSG
HWQHYSDNMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRLADFGVLHRNELSG
ALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSIFGFSFKLNLSTRPEKFLG
DIEVWDQAEKQLENSLNEFGEKWELNSGDGAFYGPKIDIQIKDAIGRYHQCATIQLDFQL
PIRFNLTYVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMVVPVG
PTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKISGTVN
IRTRDNKVHGERTISETIERLQQLKQSRSKQAEEEF
Download sequence
Identical sequences G1RVM5
XP_004088250.1.23891 ENSNLEP00000017302 ENSNLEP00000017302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]