SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017318 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017318
Domain Number 1 Region: 229-334
Classification Level Classification E-value
Superfamily Immunoglobulin 3.95e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 33-122
Classification Level Classification E-value
Superfamily Immunoglobulin 3.61e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 165-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000182
Family I set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017318   Gene: ENSNLEG00000014229   Transcript: ENSNLET00000018183
Sequence length 398
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:17400486:17477367:-1 gene:ENSNLEG00000014229 transcript:ENSNLET00000018183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSSLPSTLALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTP
EIQWWYAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASN
DPKRNDLRQNPSITWIRAQATISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLT
YSYWTKNGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDI
TGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTEL
NIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVY
EKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN
Download sequence
Identical sequences G1RVP1
ENSNLEP00000017318 ENSNLEP00000017318 XP_003267236.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]