SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017320 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017320
Domain Number 1 Region: 66-166
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000142
Family C1 set domains (antibody constant domain-like) 0.09
Further Details:      
 
Domain Number 2 Region: 173-267
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000246
Family V set domains (antibody variable domain-like) 0.002
Further Details:      
 
Domain Number 3 Region: 9-49
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000607
Family V set domains (antibody variable domain-like) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017320   Gene: ENSNLEG00000014262   Transcript: ENSNLET00000018186
Sequence length 279
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:17548360:17549942:1 gene:ENSNLEG00000014262 transcript:ENSNLET00000018186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSL
QVAAPYSKPSMTLEPSKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGAPLAGNVTTSQMA
NEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSITITPQRSPTGTVEVQVPEDPV
VALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPD
LLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQ
Download sequence
Identical sequences ENSNLEP00000017320 ENSNLEP00000017320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]