SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017321 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017321
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.06e-66
Family GDI-like N domain 0.0000000000712
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000102
Family GDI-like N domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017321   Gene: ENSNLEG00000014222   Transcript: ENSNLET00000018187
Sequence length 447
Comment pep:known_by_projection supercontig:Nleu1.0:GL397458.1:936959:943807:1 gene:ENSNLEG00000014222 transcript:ENSNLET00000018187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLE
GPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVP
STETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQD
VIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRI
ICILSHPIKSTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETT
DPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDI
YKRMAGTAFDFENMKRKQNDVFGEAEQ
Download sequence
Identical sequences G1RVP4
XP_003279338.1.23891 ENSNLEP00000017321 ENSNLEP00000017321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]