SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017364 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017364
Domain Number 1 Region: 13-150
Classification Level Classification E-value
Superfamily L domain-like 4.01e-30
Family Ngr ectodomain-like 0.0082
Further Details:      
 
Domain Number 2 Region: 188-227,255-309
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000237
Family V set domains (antibody variable domain-like) 0.05
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017364
Domain Number - Region: 465-504
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00657
Family Fibronectin type III 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017364   Gene: ENSNLEG00000014301   Transcript: ENSNLET00000018231
Sequence length 680
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:17811297:17937976:1 gene:ENSNLEG00000014301 transcript:ENSNLET00000018231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRGVLWSLVLPVTTLWLIHSPPXXXEPGALAVLSQLKNLDLSHNFISSFPWSDLRNSAL
QLLKMNHNRLGSLPRDALGALPDLRSLRINNNRLRTLAPGTFDALSALSHLQLYHNPFHC
GCSLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCAPPSVHLSAEPPLEA
PGTPLRAGLAFVLHCIADGHPTPRLQWQLQIPGGTVVLEPPVLNGEDDGVGAEEGEGEGD
GDLLTQTQAPTPTPAPAWPAPPATPRFLALANGSLLVPLLSAKEAGVYTCRAHNELGANS
TSIRVAVAATGPPKHAPGAGGEPDGQAPTSERKSTAKGRGNSVLPSKPEGKIKGQGLAKV
SILAETETEPEEDTSEGEEAEDQILADPAEEQRCGNGDPSRYVSNHAFNQSAELKPHVFE
LGVIALDVAEREARVQLTPLAARWGPGPGGAGGARRPGRRPLRLLYLCPAGGGAAVQWSR
VEEGVNAYWFRGLRPGTNYSVCLALAGEACHVQVVFSTKKELPSLLVIVAVSVFLLVLAT
VPLLGAACCHLLAKHPGKPYRLILRPQAPDPMEKRIAADFDPRASYLESEKSYPAGGEAG
GEEPEDAQGEGLDEDVEQGDPSGDLQREESLAACSLVESHSKANQEEFEAGSEYSDRLPL
GAEAVNIAQEINGNYRQTAG
Download sequence
Identical sequences ENSNLEP00000017364 ENSNLEP00000017364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]