SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017367 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017367
Domain Number 1 Region: 115-436
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.5e-63
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000145
Further Details:      
 
Domain Number 2 Region: 431-565
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.51e-31
Family Ricin B-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017367   Gene: ENSNLEG00000014277   Transcript: ENSNLET00000018234
Sequence length 571
Comment pep:known_by_projection supercontig:Nleu1.0:GL397588.1:97236:312146:1 gene:ENSNLEG00000014277 transcript:ENSNLET00000018234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRSRMLLCFAFLWVLGIAYYMYSGGGSAXXGVAGGGSGGWEDWNEIDPIKKKDLHHSN
GEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPD
TRHDQCQRKQWRVDLPPTSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSND
PEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLER
VAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAP
IKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHV
FRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKK
LSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQ
EWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCL
DSRTAKSGGLSVEVCGPALSQQWKFSLNLQQ
Download sequence
Identical sequences ENSNLEP00000017367 ENSNLEP00000017367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]