SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017371 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017371
Domain Number 1 Region: 32-381
Classification Level Classification E-value
Superfamily L domain-like 8.73e-66
Family Ngr ectodomain-like 0.016
Further Details:      
 
Domain Number 2 Region: 425-514
Classification Level Classification E-value
Superfamily Immunoglobulin 8.7e-18
Family I set domains 0.04
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017371
Domain Number - Region: 530-615
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00278
Family Fibronectin type III 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017371   Gene: ENSNLEG00000014305   Transcript: ENSNLET00000018238
Sequence length 713
Comment pep:known_by_projection supercontig:Nleu1.0:GL397353.1:6669374:6737542:-1 gene:ENSNLEG00000014305 transcript:ENSNLET00000018238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLVAPLLLAWVAGATAAVPVVPWRVPCPPQCACQIRPWYTPRSSYREATTVDCNDLFL
TAVPPALPAGTQTLLLQSNSIVRVDQSELGYLANLTELDLSQNSFSDARDCDFHALPQLL
SLHLEENQLTRLEDHSFAGLASLQELYLSHNQLYRIAPRAFSGLSNLLRLHLNSNLLRAI
DSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVLAGMNLREISDYALEGLQSLE
SLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS
IDKFALVNLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNNALSALHQQTVESLPN
LQEVGLHGNPIRCDCVIRWANATGTRVRFIEPQSTLCAEPPDLQRRPVREVPFREMTDHC
LPLISPRSFPPSLQVASGESMVLHCRALAEPEPEIYWVTPAGLRLTPAHAGRRYRVYPEG
TLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRALLQPGRDEGRGLELQVQETHPYH
ILLSWVTPPNTVSTNLTWSSASSLRGQGATALARLPRGTHSYNITRLLQATEYWACLQVA
FADAHTQLACVWARTKEATSCHRALGDHPGLIAILALAVLLLAAGLAAHLGTGQPRKGVG
GRRPLPPAWAFWGWSAPSVRVVSAPLVLPWNPGRKLPRSSEGETLSPPLSQNS
Download sequence
Identical sequences G1RVU4
ENSNLEP00000017371 XP_003273206.1.23891 XP_003273207.1.23891 XP_004088135.1.23891 XP_004088136.1.23891 XP_012362164.1.23891 ENSNLEP00000017371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]