SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017376 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017376
Domain Number 1 Region: 3975-4257
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-74
Family Protein kinases, catalytic subunit 0.00000701
Further Details:      
 
Domain Number 2 Region: 3202-3395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-31
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 3 Region: 2038-2136,5052-5150
Classification Level Classification E-value
Superfamily Fibronectin type III 2.95e-26
Family Fibronectin type III 0.00091
Further Details:      
 
Domain Number 4 Region: 2638-2733
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-23
Family I set domains 0.0058
Further Details:      
 
Domain Number 5 Region: 3526-3627
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-20
Family I set domains 0.0059
Further Details:      
 
Domain Number 6 Region: 3871-3963
Classification Level Classification E-value
Superfamily Immunoglobulin 3.61e-20
Family I set domains 0.0054
Further Details:      
 
Domain Number 7 Region: 3620-3718
Classification Level Classification E-value
Superfamily Immunoglobulin 4.91e-20
Family I set domains 0.0077
Further Details:      
 
Domain Number 8 Region: 4969-5055
Classification Level Classification E-value
Superfamily Immunoglobulin 1.31e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 9 Region: 1398-1491
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-19
Family I set domains 0.031
Further Details:      
 
Domain Number 10 Region: 2415-2508
Classification Level Classification E-value
Superfamily Immunoglobulin 8.69e-19
Family I set domains 0.005
Further Details:      
 
Domain Number 11 Region: 2885-2988
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 12 Region: 99-192
Classification Level Classification E-value
Superfamily Immunoglobulin 5.84e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 13 Region: 2777-2877
Classification Level Classification E-value
Superfamily Immunoglobulin 5.1e-17
Family I set domains 0.0038
Further Details:      
 
Domain Number 14 Region: 1146-1239
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 15 Region: 195-284
Classification Level Classification E-value
Superfamily Immunoglobulin 1.33e-16
Family I set domains 0.042
Further Details:      
 
Domain Number 16 Region: 890-978
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-16
Family I set domains 0.035
Further Details:      
 
Domain Number 17 Region: 795-887
Classification Level Classification E-value
Superfamily Immunoglobulin 4.01e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 18 Region: 1235-1327
Classification Level Classification E-value
Superfamily Immunoglobulin 4.16e-16
Family I set domains 0.026
Further Details:      
 
Domain Number 19 Region: 1487-1581
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000104
Family I set domains 0.021
Further Details:      
 
Domain Number 20 Region: 977-1066
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000185
Family I set domains 0.027
Further Details:      
 
Domain Number 21 Region: 458-547
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000344
Family I set domains 0.018
Further Details:      
 
Domain Number 22 Region: 1584-1675
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000395
Family I set domains 0.012
Further Details:      
 
Domain Number 23 Region: 371-460
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000041
Family I set domains 0.022
Further Details:      
 
Domain Number 24 Region: 540-632
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000702
Family I set domains 0.021
Further Details:      
 
Domain Number 25 Region: 714-802
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000845
Family I set domains 0.02
Further Details:      
 
Domain Number 26 Region: 1065-1154
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000917
Family I set domains 0.035
Further Details:      
 
Domain Number 27 Region: 18-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000563
Family I set domains 0.017
Further Details:      
 
Domain Number 28 Region: 1328-1402
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000917
Family I set domains 0.02
Further Details:      
 
Domain Number 29 Region: 3452-3524
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000162
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 30 Region: 1667-1762
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000269
Family I set domains 0.036
Further Details:      
 
Domain Number 31 Region: 1758-1853
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000426
Family I set domains 0.0098
Further Details:      
 
Domain Number 32 Region: 2140-2213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000762
Family I set domains 0.03
Further Details:      
 
Domain Number 33 Region: 284-371
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000147
Family I set domains 0.02
Further Details:      
 
Domain Number 34 Region: 1850-1944
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000415
Family I set domains 0.017
Further Details:      
 
Domain Number 35 Region: 1949-2042
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000483
Family I set domains 0.014
Further Details:      
 
Domain Number 36 Region: 3119-3181
Classification Level Classification E-value
Superfamily SH3-domain 0.00000337
Family SH3-domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017376   Gene: ENSNLEG00000014265   Transcript: ENSNLET00000018243
Sequence length 5156
Comment pep:known_by_projection supercontig:Nleu1.0:GL397374.1:4072716:4169773:1 gene:ENSNLEG00000014265 transcript:ENSNLET00000018243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQAQSQAQLLVQGRRVHIIEDLEDVDVQEGSSATFHCRISPANYEPVHWFLDKTPLHANE
LNEIEAQPGGYHVLTLRQLALKDSGTIYFEAGDQRASATLRVTEKPSIFSRELTDATITE
GEDLTLVCETSTCDSPVCWTKDGKTLRGSARCQLSHEGHRAQLLITGATLQDSGRYKCEA
GGAYSSSIVRVHARPVRFREALKDLEVLEGGAATLRCVLSSVAAPVEWCCGDKVLRPGDK
YSLRQEGAVLELVVRDLRPQDSGMYSCSFGDQTTSATLTVTALPAQFIGKLRNKEATEGA
TTLRCELSKAAPVEWRKGSETLRDGDRYCLRQDGAMCELQIRGLAMVDAGEYSCVCGEER
TSASLTIRAMPAHFIGRLRHQEGTEGATVTLRCELSKAAPVEWRKGRESLRDGDRHSLRQ
DGAVCELQICGLAVADAGEYSCVCGEERTSATLTVKALPAKFTEGLRNEEAVEGATVMLW
CELSKVAPVEWRKGSKNLRDGDRYILRQEGTRCELQICGLAMADAGEYLCICGQQRTSAT
LTIRALPARFIEDVKNQEAREGATAVLQCELNSAAPVEWRKGSETLRDGDRYSLRQDGTK
CELQIRGLAMADSGEYACVCGQERTLAVLTVRASTPCASKDGLHHVEAMEGATATVLTGW
SMGSPSPQPVLSTPRVACVQLGSMSSLCHPCSVSSMCSESMIVFIYSDPPPALPIKFTEG
LRNEEATEGAMATLWCELSKVAPVEWRKGHETLRDGDRHSLRQDGSRCELQIRGLAVVDA
GEYSCVCGQERTSATLTVRALPARFIEDVKNQEAREGATAMLQCELSKAAPVEWRKGSEI
LRGGDRYSLRQDGTRCELQIHGLSMADTGEYSCVCGQERTSATVTIRALPARFTRDLKTK
ETSEGATATLQCELSKVTPVEWKKGPETLRDGGRYSLKQDGTRCELQIHDLSVADAGEYS
CMCGQERTSAMLTVRALPARFTEGLRNEEAMEGATATLQCELSKAAPVEWRKGLEALRDG
DKYSLRQDGAVCELQIHGLAMADTGVYSCVCGQERTSATLTVRALPARFIEDMRSQKATE
GATVTLQCKLRKAAPVEWRKGPNTLKDGDRYSLKQDGTRCELQIRGLVIADAGEYSCICE
QERTSAMLTVRALPARFIEDVRNHEATEGATAVLQCELSKAAPVEWRKGSETLRDGDRHS
LRQDGTRCELQIRGLAVEDTGEYLCVCGQERTSATLTVRALPPRFIDNMTNQEAREGATA
TLQCELSKAAPVEWRKGPETLRDGDRHSLRQDGTRCELQIRGLAVVDAGEYSCVCGQERT
SATLTIREATEGATAMLQCELSKAAPVEWRKGPETLRDGDRYNLRQDGTRCELQIHGLSM
ADTGEYSCVCGQEKTSATLIVKAPQPVFREPLQSLQAEEGSTATLQCELSEPTATVVWSK
GGLQLQANGRREPRLQGCTAELVLRGLQREDTGEYTCTCGSQATSATLTVTAAPVRFLQE
LQPQEVDEGGTAHLRCELSRAGVSVEWRKGSLQLFPCAKYQMVQDGAAAELLVRGVEQED
AGDYTCDTGYTQSMASVSVRVPRPKFKTRLQSLEQETGDIARLCCQLSDAESGATVQWLK
EGVELHAGPKYEMRSQGVTRELLIHQLEAKDTGEYACVTGGQKTAASLRVTEPEVTIVRG
LVDVEVPADEDVEFSCEVSRAGATGVQWCLQGLPLQSNEVTEVAVRDGRIHTLRLKGVTP
EDAGTVSFHLGNHASSAQLTIRAPEVTILEPLQDVQLSEGQDASFQCRLSRASGQEAHWA
LGGVPLQANEMNDIAVEQGTLHLLTLHKVTLEDAGTVSFHVGTCSSEAQLKVTAKNTVVR
GLENVEALEGGEALFECQLSQPEVAAHTWLLDDEPVHTSENAEVVFFENGLRHLLLLKNL
RPQDSCRVTFLAGDMVTSAFLTVRGWRLEILEPLENAAVRAGAQARFTCTLSEAVPLGEA
CWYINGAAVQPDDSDWTVTADGSHHNLLLRSAQPHHAGEVTFACRDAVASARLTVLGLPD
PPEDAEVVARSSHTVTLSWAAPMSDGGGGLCGYRVEVKEGATGQWRLCHELVPGPECVVD
GLTPGETYRFRVAAVGPVGAGEPVHLPQTVRLAEPPKPVPPQSSAPESRQVAAGEDVCLE
LEVAAEAGEVIWYKGTECIQPSGRFEVVSQGRRQMLVIRDFTAEDQGEYHCGLAQGSTCP
MAATFQVALSPASVDEAPPQPSLPPEAAQEGDLHLLWEALARKRRMSREPTLDSISELPE
EDGRSQRLPQEAEEVAPDLSEGYSTADELARTGDADLSHTSSDDESRAGTPSLVTYLKKA
GRPGTSPLASKVGAPGARSVKPQQQQEPLAAVHPPLGDLSTKDLGDPSMDKAAVKIQAAF
KGYKVRKEMKQQEGPMFSHTFGDTEAQVGDALRLECVVASKADVRARWLKDGVELTDGRH
HHIDQLGDGTCSLLITGLGHADAGRYTCQVSNKFGQVAHSACVVVSGTESEAESSSGGEL
DDAFRRAARRLHRLFRTKSPAEVSDEELFLSADEGPAEPEEPADWQTYREDEHFICIRFE
ALTEARQAVTRFQEMFATLGIGVEIKLVEQGPRRVEMRISKETPTSMVPPEPLPSLLTSD
TAPVFLTELQNQEVQDGYPVSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQ
LIITAVVPADMGVYRCLAENSMGVSSTKAELRVDLTSTDYDTAADATETSSYFSAQGYLS
SREQEGTESTTDEGQLPQVVEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTA
SAHIRMTDRIPMHTLEIISVTQEDSGQYAAYISNAMGAAYSSARLLVRGPDEPEEKPASD
VHEQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPAPTVHWLREEAEMGVLWIGPETPGY
TVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCSASLHVSGLPKVEEQEKVKEALI
STFLQGTTQAVSAQGLETASFADLGGQRKGEPLAAREALGHLSLAEVGTEEFLQKLTSQI
TEMVSAKITQAKLQVPGGDSDEDSKTPSASPRHGRSRPSSSIQESSSESEDGDARGEIFD
IYVVTADHLPLGAEQDAIALREGQYVEVLDAAHPLRWLVRTKPTKSSPSRQGWVSPAYLD
RRLKLSPEWGAAEAPEFPGEAVSEDEYKSRLSSVIQELLSSEQAFVEELQFLQSHHLQHL
ERCPHVPAAVAGQKTVIFRNVRDIGHFHSSFLQELQQCDTDDDVAMCFIKNQAAFEQYLE
FLVGRVQAESVVVSTAVQEFYKKYAEEALSAGDPSQPPPPPLQHYLEQPVERVQRYQALL
KELIRNKARNRQNCALLEQAYAVVSALPQRAENKLHVSLIENYPGTLEALGEPIRQTHVM
WVGGGGGCVSWAGHWADRSPHPPPGPLHRPRRDSHTDTFSYVFRNMMKLSSIDLNDQVEG
DDRAFEIWQEREDSVRKYLLQARTAIIKSSWVKQICGIQQRLALPVWRSPDFEEELADCT
AELGETVKLACRVTGTPKPVISWYKDGKPVQVDPHHILIEDPDGSCALILDSLTGVDSGQ
YMCFAASAAGNCSTLGKILVQVPPRFVNKIRASPFVEGEDAQFTCTIEGAPYPQIRWYKD
GALLTPGSKFQTLSEPRSGLLVLVIRVAGKEDLGLYECELVNRLGSARASAELHIQSPTL
QAREQCHREQLVAAVEDTTLERADQEITSVLERLLDPKAPGPSTGDLTGPGPCPGRGPAL
QETGSQPPVTGISEAPAVPPKVPQPLLHEGPEQEPEAIARAQEWTVPIRMEGAAWPGAGT
GELLWDVHSHVVTETTQRTYTYQAIDTHTARPPSMQVTIEDVQAQTGGTAQFKAIIEGDP
QPLVTWYKDSVQLVDSTQLSQQQEGTTYSLVLRHVSSKDAGVYTCLAQNAGGQVLCKAEL
LVLGGDNEPDSEKQSHRRKLHSFYEVKEEIGRGVFGFVKRVQHKGNKILCAAKFIPLRSR
TRAQAYRERDILAALSHPLVTGLLDQFETRKTLILILELCSSEELLDRLFRKGMVTEAEV
KVYILQLVEGLHYLHSRGVLHLDIKPSNILMVHPAREDIKICDFGFAQNITPAELQFSQY
GSPEFVSPEIIQQNPVSEASDIWAMGVISYLSLTCSSPFAGESDRATLLNVLEGRVSWSN
PMAAHLSEDAKDFIKATLQRAPQARPSAAQCLSHPWFLKSMPAEEAHFINTKQLKFLLAR
SRWQRSLMSYKSILVMRSIPELLRGPPDSPSLGVARHLCRDTGGSSSSSSSSDNELAPFA
RAKSLPPSPVTHSPLLHPRGFLRPSASLPEEAEASERSTEAPAPPASPEGAGPPAAQGCV
PRHSVIRSLFYQQGGESPESGALAPGSRRHPARRRHLLKGGYIAGALPGLREPLMEHRVL
EEEAAREEQATLLAKAPSSETALRLPASGTHLAPGHSHSLEHDPPGTPCPSPEACCEAQR
LPSAPSGGAPIRDMGHPQGSKQLPSSGGHPGTAQPERPSPDSPWGQPSPFCHPKQGSAPQ
EGCSPQPAVAPCPPGSLPPGSCKEAPLVPSSPFLGQPQAPPAPAKASPPLDSKMGPGDIS
LPGRPKPGPCSSPGVSSQETSSQVSSLRVGSSRVGTEPGPSLDAEGWSQEAEDLSDSTPT
LQRPQEQATTRKFSLGCRGGYAGVAGYGTFAFGGDAGGMLGQGPMWARIAWAVSQSSEEQ
EEARAESPLPQVSASPVPEVGRAPSRTSPEPTPWEDVGQVSLVQIRDLSGDAEAADTISL
DISEVDPAYLNLSDLYDIKYLPFEFMIFRKVPKPAQPEPPSPMAEEELDEFPEPTWPWPG
ELGPHAGLEITEEPEDMDALLAEAAVGRKRKWSSPSRSLFHFPGRHLPLDEPAELGLRER
VKASVEHISRILKGRPEGEPPPHPSCTVLGLHVSSVLCGLEVWGECTDILRELSDETVVL
GQSVTLACQVSAQPAAQATWSKDGAPLESSSRVLISTTLKNFQLLTILVVVAEDLGVYTC
SVSNALGTATTTGILRKAERPSSSPCPDIGEVYADGVLLVWKPVESYGPVTYIVQCSLEG
GSWTTLASDIFDCCYLTSKLSRGGTYTFRTACVSKAGMGPYSSPSEQVLLGGPSHL
Download sequence
Identical sequences ENSNLEP00000017376 ENSNLEP00000017376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]