SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017401 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017401
Domain Number 1 Region: 283-460
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-64
Family SPRY domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-22
Family RING finger domain, C3HC4 0.0074
Further Details:      
 
Domain Number 3 Region: 82-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017401
Domain Number - Region: 128-205
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0706
Family Apolipoprotein 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017401   Gene: ENSNLEG00000014315   Transcript: ENSNLET00000018268
Sequence length 472
Comment pep:known_by_projection supercontig:Nleu1.0:GL397374.1:4189577:4203851:-1 gene:ENSNLEG00000014315 transcript:ENSNLET00000018268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELS
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCPAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKAKLEKSLEHLRKQMQNKLQDALLFQAQADETCVLWQKMVESQRQ
NVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAARLGQQSAHLAELIAELEGRC
QLPALGLLQDIKDALRRVQDVKLQPPEVVPMELRTVCRVPGLVETLRRFRGDVTLDPDTA
NPELILSEDRRSVQRGDLRQALPDSPERFDPGPCVLGQERFTSGRHYWEVEVGDRTSWAL
GVCRENVNRKEKGELSAGNGFWILVFLGSYYNSSERALAPLRDPPRRVGIFLDYEAGHLS
FYSATDGSLLFIFPEIPFSGTLRPLFSPLSSSPTPMTICRPKGGSGDTLAPQ
Download sequence
Identical sequences G1RVX4
ENSNLEP00000017401 XP_003275191.1.23891 ENSNLEP00000017401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]