SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017440 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017440
Domain Number 1 Region: 35-145
Classification Level Classification E-value
Superfamily Immunoglobulin 3.46e-24
Family V set domains (antibody variable domain-like) 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017440   Gene: ENSNLEG00000014351   Transcript: ENSNLET00000018309
Sequence length 248
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11744296:11749740:-1 gene:ENSNLEG00000014351 transcript:ENSNLET00000018309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGAPSSSPSPILAMLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSD
DISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYS
DNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVR
YCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGL
GESRKDKK
Download sequence
Identical sequences G1RW13
XP_003258807.1.23891 ENSNLEP00000017440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]