SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017472 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017472
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 2.53e-40
Family Globins 0.0000000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017472   Gene: ENSNLEG00000014375   Transcript: ENSNLET00000018342
Sequence length 154
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:15713673:15724627:-1 gene:ENSNLEG00000014375 transcript:ENSNLET00000018342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH
PGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Download sequence
Identical sequences G1RW45 P62734 P62735
ENSNLEP00000017472 XP_003264735.1.23891 XP_003264737.1.23891 ENSNLEP00000017472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]