SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017475 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017475
Domain Number 1 Region: 828-1018
Classification Level Classification E-value
Superfamily Fibronectin type III 3.75e-32
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 2 Region: 627-824
Classification Level Classification E-value
Superfamily Fibronectin type III 9.38e-29
Family Fibronectin type III 0.0000632
Further Details:      
 
Domain Number 3 Region: 254-343
Classification Level Classification E-value
Superfamily Immunoglobulin 1.89e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 4 Region: 428-525
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 515-610
Classification Level Classification E-value
Superfamily Immunoglobulin 2.49e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 6 Region: 336-431
Classification Level Classification E-value
Superfamily Immunoglobulin 4.6e-17
Family I set domains 0.0042
Further Details:      
 
Domain Number 7 Region: 37-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000329
Family I set domains 0.011
Further Details:      
 
Domain Number 8 Region: 146-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000111
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 1126-1201
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000206
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017475   Gene: ENSNLEG00000014308   Transcript: ENSNLET00000018345
Sequence length 1345
Comment pep:known_by_projection supercontig:Nleu1.0:GL397353.1:6978995:7078532:1 gene:ENSNLEG00000014308 transcript:ENSNLET00000018345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPLCTVAVTQPPTITKQSVKDHIVDPRDNIL
IECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFA
RNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVA
ERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKA
LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN
AFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHV
YENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVAKRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQ
DLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITD
YVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVT
VWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYPRAAPTEVKVRVMNST
AISLQWNRVYSDTVQGQLREYRAYYWRESSLLKNLWVSQKRQQASFPGDRLRGVVSRLFP
YSNYKLEMVVVNGRGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNG
IMIGYTLKYVAFNGTKVGKQIVENLSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGEAVT
EESPAPPNEATPTAAPPTLPPTTVGATGAVSSTDATAIAATTEATTVPIIPTVAPTTIAT
TTVATTTTTTAATTTTESPPTTTSRTKIHESAPDEQSIWNVTVLPNSKWANITWKHNFGP
GTDFVVEYIDSNHTKKTVPVKAQAQPIQLTDLYPGMTYTLRVYSRDNEGISSTVITFMTS
TAYTNNQADIATQGWFIGLMCAIALLVLILLIVCFIKRSRGGKYPVREKKDVPLGPEDPK
EEDGSFDYXXXXKQALQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYTVK
KDKEETEGNESSEATSPVNAIYSLA
Download sequence
Identical sequences ENSNLEP00000017475 ENSNLEP00000017475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]