SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017503 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017503
Domain Number 1 Region: 145-338
Classification Level Classification E-value
Superfamily E set domains 5.6e-54
Family Cytoplasmic domain of inward rectifier potassium channel 0.00025
Further Details:      
 
Domain Number 2 Region: 36-187
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-25
Family Voltage-gated potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017503   Gene: ENSNLEG00000014398   Transcript: ENSNLET00000018374
Sequence length 360
Comment pep:known_by_projection supercontig:Nleu1.0:GL397366.1:6069939:6080722:-1 gene:ENSNLEG00000014398 transcript:ENSNLET00000018374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSNCKVIAPLLSQRYRRMVTKDGHSTLQMDGAQRGLAYLRDAWGILMDMRWRWMMLVF
SASFVVHWLVFAVLWYVLAEMNGDLELDHDAPPENHTICVKYITSFTAAFSFSLETQLTI
GYGTMFPSGDCPSAIALLAIQMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDIAVVAH
MDGKPNLIFQVANTRPSPLTSVRVSAVLYQERENGKLYQTSVDFHLDDISSEECPFFIFP
LTYYHSITPSSPLATLLQHENPSHFELVVSLSAMQEGTGEICQRRTSYLPSEIMLHHCFA
SLLTRGSKGEYQIKMENFDKTVPEFPTPLVSKSLNRTDLDIHINGQSIDNFQISETGLTE
Download sequence
Identical sequences G1RW76
ENSNLEP00000017503 ENSNLEP00000017503 XP_003274798.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]