SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017507 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017507
Domain Number 1 Region: 602-808
Classification Level Classification E-value
Superfamily Fibronectin type III 3.06e-32
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 2 Region: 317-383,436-502
Classification Level Classification E-value
Superfamily Immunoglobulin 4.06e-25
Family I set domains 0.0014
Further Details:      
 
Domain Number 3 Region: 796-912
Classification Level Classification E-value
Superfamily Fibronectin type III 9.15e-25
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 4 Region: 231-324
Classification Level Classification E-value
Superfamily Immunoglobulin 8.4e-19
Family I set domains 0.00011
Further Details:      
 
Domain Number 5 Region: 506-608
Classification Level Classification E-value
Superfamily Immunoglobulin 6.95e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 6 Region: 35-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000063
Family I set domains 0.0000582
Further Details:      
 
Domain Number 7 Region: 160-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000244
Family I set domains 0.00012
Further Details:      
 
Domain Number 8 Region: 902-991
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000189
Family Fibronectin type III 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017507   Gene: ENSNLEG00000014386   Transcript: ENSNLET00000018379
Sequence length 1036
Comment pep:known_by_projection supercontig:Nleu1.0:GL397353.1:7114708:7136086:1 gene:ENSNLEG00000014386 transcript:ENSNLET00000018379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTATRRKPHLLLVAAVALVSSSAWSSALGSPTTFGPVFEDQPLSVLFPEESTEEQVLLA
CRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLASNPVGTV
VSREAILRFGWLAELHQHAGVPPRPSTPWFPQTPRILGLSYRWLLNEFPNFIPTDGRHFV
SQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARF
PAETYALVGQQVTLECFAFGNPVPRIKWRKVDGSLSPQWTTVEPTLQIPSVSFEDEGTYE
CEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRWLRNGE
PLASQVGDVGLPPTHHNCALLTCSTSGLIRVSQGGPRTTWGLLPIPAQFTLAPDFRLNPV
RRLIPAARGGEIIIPCQPRAAPKAVVLWSKGTEILVNSSRVTVTPDGTLIIRNISRSDEG
KYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTW
TLDDFPIDFDKPGGHYRRTNVKETIGDLTILNAQLRHGGKYTCMAQTVVDSASKEATVLV
RGPPGPPGGVVVRDIGDTTIQLNWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIE
GNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTKEAAPSVAPSGLSGGGGAP
GELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTARVPGADAQYFVYSNESVRPYTPF
EVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWEPVQQDMNGIL
LGYEIRYWKAGDKEAAADRVRTAGLDTSARVSGLHSNTKYHVTVRAYNRAGTGPASPSAN
ATTMKPPPQRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLT
GKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTI
VSHSVAMLILIGSLEL
Download sequence
Identical sequences ENSNLEP00000017507 ENSNLEP00000017507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]