SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017526 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017526
Domain Number 1 Region: 106-141
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000222
Family CCCH zinc finger 0.00023
Further Details:      
 
Domain Number 2 Region: 144-171
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000628
Family CCCH zinc finger 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017526   Gene: ENSNLEG00000014418   Transcript: ENSNLET00000018400
Sequence length 330
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:2229669:2231944:-1 gene:ENSNLEG00000014418 transcript:ENSNLET00000018400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANRYTMDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGLWSLSPSDSSPSGVTSRL
PGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSE
SGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHIHNPSEDLKKK
KERVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAP
GTPVARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDS
PVFEAGVFAPPQPVAAPRRLPIFNRISVSE
Download sequence
Identical sequences ENSNLEP00000017526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]