SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017529 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017529
Domain Number 1 Region: 9-373
Classification Level Classification E-value
Superfamily Sialidases 4.77e-110
Family Sialidases (neuraminidases) 0.00000000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017529   Gene: ENSNLEG00000014420   Transcript: ENSNLET00000018403
Sequence length 380
Comment pep:known_by_projection supercontig:Nleu1.0:GL397366.1:6344591:6346970:1 gene:ENSNLEG00000014420 transcript:ENSNLET00000018403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLPVLQKDSVFQSGAQAYRIPALLYLPGQQTLLAFAEQRASKKDEHAELIVLRRGGYD
VPTRQVQWQAQEVVAQARLDGHRSLNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTGAN
VTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFGVGPGHCLQLHNRAQSLVVPAYA
YRNLHPIQRPSPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVEAGEQRVVTLNARSHL
RARVQAQSNNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTH
SWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYE
EIVFLMFTLKQAFPAECLPQ
Download sequence
Identical sequences G1RWA2
ENSNLEP00000017529 ENSNLEP00000017529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]