SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017564 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017564
Domain Number 1 Region: 32-391,432-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017564   Gene: ENSNLEG00000014414   Transcript: ENSNLET00000018439
Sequence length 581
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:31932845:31964288:-1 gene:ENSNLEG00000014414 transcript:ENSNLET00000018439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGRGLCKAVAASPFPAWRRAHTEAGGGLKPEYDAVVIGAGHNGLVAAAYLQRLGVNT
AVFERRHVIGGAAVTEEIIPGFKFSRASYLLSLLRPQIYTDLELKKHGLRLHLRNPHSFT
PMLEEGVGSKVPRSLLLGTDMAENQKQIAQFSRKDAQVFPKYEEFMHRLALAIYPLLDAA
PVDMAAFQRGSLLQRMRSLSTLKPLLKAGRILGAQLPRYYEVLTAPITKVLDQWFESEPL
KATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWAYVQGGMGALSDAIASSATT
HGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLKLTPQEWLPEE
FLERISQLDTRSPVTKINVAVDRLPSFLVAPNAPRGQPLPHHQCSIHLNCENTLLLHQAF
EDAVYGLPSHRPMIELCIPSSLDPTLAPPGCHVVSLFTQYTPYTLAGGKAWDEQERDAYA
DRVFDCIEAYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHS
GYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVAFRDLKSM
Download sequence
Identical sequences ENSNLEP00000017564 ENSNLEP00000017564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]