SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017606 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017606
Domain Number 1 Region: 132-217
Classification Level Classification E-value
Superfamily Immunoglobulin 4.42e-16
Family I set domains 0.00000599
Further Details:      
 
Domain Number 2 Region: 47-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000216
Family I set domains 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017606   Gene: ENSNLEG00000014413   Transcript: ENSNLET00000018484
Sequence length 310
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11992366:12008953:1 gene:ENSNLEG00000014413 transcript:ENSNLET00000018484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILSFLPVLATESDWAGCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGAHSPESDSTQWFHNGNLIPTYTRPSYRFKAYNNDSGEYRCQTGPTSL
SDPVHLTVFSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYVLYSSKPVTITVQAPSSSPMGIIVAVVTGTAVAAIVAA
VVALIYCRKKRISALSGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI
Download sequence
Identical sequences A0A2I3H964
ENSNLEP00000017606 ENSNLEP00000017606 XP_004089882.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]