SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017611 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017611
Domain Number 1 Region: 64-494
Classification Level Classification E-value
Superfamily Sema domain 1.14e-112
Family Sema domain 0.00000144
Further Details:      
 
Domain Number 2 Region: 491-527
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000061
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 543-619
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000756
Family I set domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017611   Gene: ENSNLEG00000014432   Transcript: ENSNLET00000018489
Sequence length 664
Comment pep:known_by_projection supercontig:Nleu1.0:GL397307.1:18228486:18255491:-1 gene:ENSNLEG00000014432 transcript:ENSNLET00000018489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPPPPGRAAPSAPRARVPGPPAWSGLPLRLLLLLWAAAASAQGHLRSGPRIFAVWKGHV
GQDRVDFGQTEPHPVLFLEPGSSSLWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLD
KRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLF
EGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKIYY
FFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNFNR
LQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPNPR
PGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVVVHRMQASHGE
TFHVLYLTTDRGTIHKVVEPGEQEHSFVFNIMEIQPFRRAAAIQTMSLDAERRKLYVGSQ
WEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDQGRCVSIYSSERSVLQSINPAEPHKECP
NPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIEN
LTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACVLAASLWLGVLPTLTLG
LLVH
Download sequence
Identical sequences G1RWI4
ENSNLEP00000017611 XP_003267255.1.23891 XP_012362897.1.23891 ENSNLEP00000017611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]