SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017612 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017612
Domain Number 1 Region: 39-302
Classification Level Classification E-value
Superfamily L domain-like 2.25e-42
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 2 Region: 378-453
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000419
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 3 Region: 294-353
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000937
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017612   Gene: ENSNLEG00000014481   Transcript: ENSNLET00000018490
Sequence length 501
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:2323000:2330054:1 gene:ENSNLEG00000014481 transcript:ENSNLET00000018490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGPFSSVLFSPPPAAMPFLLLLWAGASRGQPCPGRCICQNVAPTLTMLCAKTGLLFVP
PAIDRRVVELRLTDNFIAAVRRRDFANMTSLVHLTLSRNTIGQVAAGAFADLRALRALHL
DSNRLAEVRGDQLRGLGNLRHLILGNNQIRRVESAAFDAFLSTVEDLDLSYNNLEALPWE
AVGQMVNLNTLTLDHNLIDHIAEGTFVQLHKLVRLDMTSNRLHKLPPDGLFLRSQGTGPK
PPTPLTVSFGGNPLHCNCELLWLRRLTREDDLETCATPEHLTDRYFWSIPEEEFLCEPPL
ITRQAGGRALVVEGQAVSLRCRAVGDPEPVVHWVAPDGRLGNSSRTRVRGDGTLDPGSSD
IATPGRPGAYDSAAERRLVAAELTSNSVLIRWPQRPVPGIRMYQVQYNSSVDDSLVYRMI
PSTSQTFLVNDLAAGRAYDLCVLAVYDDGATALPATRVVGCVQFTTAGDPAPCRPLRAHF
LGGTMIIAIGGVIVASVLVFI
Download sequence
Identical sequences ENSNLEP00000017612 ENSNLEP00000017612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]