SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017630 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017630
Domain Number 1 Region: 192-285
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000178
Family I set domains 0.03
Further Details:      
 
Domain Number 2 Region: 101-189
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000889
Family I set domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017630   Gene: ENSNLEG00000014480   Transcript: ENSNLET00000018509
Sequence length 382
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:12039357:12050743:1 gene:ENSNLEG00000014480 transcript:ENSNLET00000018509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKISVGVAGDLNTVTMKLGCVLMAWALYLSLGVLWVAQMLLAAGCDAAASFETLQCEG
PVCIEESSCHMEDDLTDAREAGFQVKGYTFSEPFHLIVSYDWLILQGPAKPVFEGDLLVL
RCKAWQDWPLTQVTFYRDGSALGPPGPNREFSIAMVQEADSGHYHCSGIFQSPGPGSPET
ASVVAITVQELFPAPILRAVPSAEPQAGGPMTLSCQTKLPLQRSAARLLFSFYKDGRIVQ
RGGLSSEFQIPTASEDHSGSYWCEAATEDNQVWKQSPQLEIRVQGAPSSAAPPTLNPAPQ
KSAAPGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGH
LLLELRELSGHQKPGTTKATAE
Download sequence
Identical sequences A0A2I3GG86
XP_003258816.1.23891 ENSNLEP00000017630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]