SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017647 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017647
Domain Number 1 Region: 102-191
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000541
Family I set domains 0.001
Further Details:      
 
Domain Number 2 Region: 20-101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000097
Family I set domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017647   Gene: ENSNLEG00000014502   Transcript: ENSNLET00000018526
Sequence length 426
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:12055401:12060891:1 gene:ENSNLEG00000014502 transcript:ENSNLET00000018526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALTALLLLVPSSGQAATLEKPVLSLHPPWTTIFKGERVTLKCDGYHPLLLELRPISTL
WYLGHLLLPSHKKSIEVQTPGVYRCQTRGAPVSDPIHLSVSNDWLILQVPYAPVFEGEPL
VLRCRGWYDKVVYKLHYYHDGQAVRYFHSSANYTVLQARASDSGRYQCSGTMRIPVESAP
MFSAKVAVTVQELFRAPVLRVMGPREARGAALGGVVLLCDTRLHPQKRDTPLQFAFYKYS
RAVRRFNWGAEYTVPEPEVEELESYWCEAATATRSVRKRSPWLQLPGPGSPLDPASTTAP
APWAAALAPGNKPLSFRKPPVSRSVPWVTTVPNTTSTGLQFPASGAPTAGPPACAPPTPL
EQSAGALKPDVNLLLREMQLLKGLLSRVVLELKEPQALPELRGTPETPTSHFAVSPGTPE
TTPVES
Download sequence
Identical sequences A0A2I3HKS7
ENSNLEP00000017647 ENSNLEP00000017647 XP_003258814.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]