SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017678 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017678
Domain Number 1 Region: 31-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000121
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 198-242
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 101-166
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000162
Family Fibronectin type I module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017678   Gene: ENSNLEG00000014522   Transcript: ENSNLET00000018560
Sequence length 349
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:23691013:23694275:-1 gene:ENSNLEG00000014522 transcript:ENSNLET00000018560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAANVGPVRVAFVLLLALYSRKAVGQNCSGPCRCPAEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Download sequence
Identical sequences G1RWQ1
XP_003255766.1.23891 ENSNLEP00000017678 ENSNLEP00000017678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]