SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017683 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017683
Domain Number 1 Region: 314-400,822-907
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000644
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 2 Region: 113-157
Classification Level Classification E-value
Superfamily Elafin-like 0.00000222
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 3 Region: 501-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000405
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 390-475
Classification Level Classification E-value
Superfamily SEA domain 0.0000615
Family SEA domain 0.013
Further Details:      
 
Domain Number 5 Region: 261-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000925
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017683
Domain Number - Region: 1018-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000234
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 920-954
Classification Level Classification E-value
Superfamily SEA domain 0.00994
Family SEA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017683   Gene: ENSNLEG00000014490   Transcript: ENSNLET00000018566
Sequence length 1446
Comment pep:known_by_projection supercontig:Nleu1.0:GL397505.1:239024:308775:1 gene:ENSNLEG00000014490 transcript:ENSNLET00000018566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRTSGLALLALVSAVGPSQASGFTEKGLSLLGYQLCSHRVTHTVQKVEAVQMSYMTYVS
CGGWIPWRRCPKTVYRIQYLVVEVPESRNVTDCCEGYEQLGFYCVLPLNQSREFTSRPGV
CPAEGPEPSTSPCSLDTDCPGLEKCCPWSGGRCCVAPAPQAPERDPTGSWYNVTILVKMD
FEELQQVDPRLLNHMRLLHALVTSALQPMASTIHHLHSAPGDAATTVSRLLLGLSRPLPV
ANVSALLGDIAKRVYEVISIQVQDVNECSYKELNACSGRELCANLEGSYQCVCHQEAPAT
SPRNLNLVWEDCPPLSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGVELLRSARTRS
QALAVAGLEPGVLYRVKTSYQGCGADVSTTLTVKTDAQVFEVTIRIVNHNLTEKLLNRSS
MEYQDFSRQLLHEVESSFPPAVSDLYRNGKLRMQIVSLQAGSVVVRLKLTVQDPGFPVGI
STLAPMLQPLLASTVFQIDRQGTRVQDWDECVDTAEHDCSPAAWCINLEGSYTCQCRTAR
DATPSRAGRACEGDLVSPTGGGLSAAAGVTVPALGTGTAALGLENFTLSPSPGHPQGTPA
AGQAWTPEPPPRRGGSSVVGYDRNNTGKGVEQEVASTAPGLGMDQGSPSQVNPSQGSPSQ
GSLRQGSTSQASPSQANSSQGSPSHVNSSQGSTSHANTSHVNSSQGSPSQASTSQASPSQ
GSPSHMNTIGVIGTTSSPKAPGSTHSFPPGATDGPLALPGQLQGNSTMEPPSWPSPTEDP
AGHVMWHATRSTRETLLNLTWLRNEDSGPSGSVALPLTPTLTALKTPTCVPVSIGRIVVS
NVTSTGFHLAWEAGLALDSAFQLTLTSTWSPTVVLETWNTSVTLSGLEPGVLHLVEILAK
ACGKEGARAHLKVRTAAQKLVGKVRITNVRYSESFRNASSQEYRDFLELFFRTVRGSLPA
TLCQHMDAGGVRMEVIGITNGSVVVEFHLLIIADVHVQEVSAAFLTAFQTAPLLEVIRGD
TFIQDYDECERKEDDCVPGTSCRNTLGSFTCSCEGGAPDFPVEYSERPCEGDSPGNETWA
TSPERPLTTAGTKAAFVQGTSPTPQGLPQRLNLTGAVRVLCEIEKVVVAIQKRFLQQESI
PESSLYLSHPSCNVSHSNGTHVLLEAGWSECGTVMQSNVTNTVVRATLRNDLSQEGIIHH
PKILSPIYCAFQNDLLTSSGFTLEWGVYTVIEDLHGAGNFVTEMQLFIGDSPIPQNYSVS
ASDDVKIEVGLYRLKSNLTVVLTECWATPSSNAWDPVTFSFINNSCPVPNTYTNVIENGN
SNKAQFKLRVFSFINNSIVYLHCRLRICMESPGATCKINCNNFRLLQNSETSATHQMSWG
PLIRSEGEPPRAEAGLGAGYVVLIAVAIFVLVAGTATLLIVRYQRMNGRYNFKIQSNNFS
YQVFYE
Download sequence
Identical sequences ENSNLEP00000017683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]