SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017696 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017696
Domain Number 1 Region: 759-873
Classification Level Classification E-value
Superfamily Fibronectin type III 4.08e-25
Family Fibronectin type III 0.00066
Further Details:      
 
Domain Number 2 Region: 449-535
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-17
Family I set domains 0.0016
Further Details:      
 
Domain Number 3 Region: 159-260
Classification Level Classification E-value
Superfamily Immunoglobulin 2.88e-17
Family I set domains 0.0000025
Further Details:      
 
Domain Number 4 Region: 656-770
Classification Level Classification E-value
Superfamily Immunoglobulin 6.25e-17
Family I set domains 0.00000239
Further Details:      
 
Domain Number 5 Region: 371-460
Classification Level Classification E-value
Superfamily Immunoglobulin 9.67e-17
Family I set domains 0.0000238
Further Details:      
 
Domain Number 6 Region: 546-623
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000679
Family I set domains 0.0046
Further Details:      
 
Domain Number 7 Region: 12-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000526
Family I set domains 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017696   Gene: ENSNLEG00000014525   Transcript: ENSNLET00000018579
Sequence length 874
Comment pep:known_by_projection supercontig:Nleu1.0:GL397449.1:1452392:1467596:-1 gene:ENSNLEG00000014525 transcript:ENSNLET00000018579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPGKKPVSAFSKKPRSVEVAAGSSAVFEAETERAGVKVRWQRGGSDISASNKYGLATE
GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAPAEATGAPG
EAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARV
AGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFAGSYR
CEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGSGRRISDSHEDTGILDFSSL
LKKSSSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRD
EKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGRYIFESIGAKR
TLTISQCSLADDAAYQCMVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSE
EGAQVKWLKDGVELTREETFKYRFKKDGRRHHLIINEATLEDAGHYTLRTSGGQALAELI
VQEKKLEVYQSIADLTVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVH
KLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRVPDTI
VVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDVPEDTGDSDEWVFDKKLLC
ETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPK
ISNVGEDSCTVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEG
VVYEMRVYAVNAIGMSRPSPASQPFMPIGEPAWP
Download sequence
Identical sequences ENSNLEP00000017696 ENSNLEP00000017696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]