SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017748 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017748
Domain Number 1 Region: 41-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000037
Family I set domains 0.0078
Further Details:      
 
Domain Number 2 Region: 237-340
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000406
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 
Domain Number 3 Region: 139-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000669
Family I set domains 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017748   Gene: ENSNLEG00000014582   Transcript: ENSNLET00000018635
Sequence length 398
Comment pep:known_by_projection supercontig:Nleu1.0:GL397368.1:3737122:3767713:1 gene:ENSNLEG00000014582 transcript:ENSNLET00000018635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRLYVLVMGVSAFTLQPASHTGAAGSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSVRTVPGEEETRMWAQDGALWLLPALQEDSGTYVCITRNASHCDKMS
IELRVFENTDASLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANGTHIESAYRGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVRNTLSFQTLRTIVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPRHQDFQSYPK
Download sequence
Identical sequences G1RWX1
ENSNLEP00000017748 ENSNLEP00000024382 XP_003274918.1.23891 XP_003274919.1.23891 ENSNLEP00000017748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]