SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017762 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017762
Domain Number 1 Region: 20-113
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-23
Family V set domains (antibody variable domain-like) 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017762   Gene: ENSNLEG00000014608   Transcript: ENSNLET00000018649
Sequence length 114
Comment pep:novel supercontig:Nleu1.0:GL397280.1:1108942:1109582:1 gene:ENSNLEG00000014608 transcript:ENSNLET00000018649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLVPMLQMIFTLGGTRAQSVTQLDSHVSVSEGTLVLLRCNYSSSVSPNLFWYVQYPN
QGLQLLLKYISGTTLVKGINGFEAEFKKSETSFHLTKPSAHVSDAAEYFCAVSD
Download sequence
Identical sequences ENSNLEP00000017762 ENSNLEP00000017762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]