SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017778 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017778
Domain Number 1 Region: 380-543
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.88e-23
Family Toll/Interleukin receptor TIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 225-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000107
Family I set domains 0.00000221
Further Details:      
 
Domain Number 3 Region: 137-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000134
Family I set domains 0.0000137
Further Details:      
 
Domain Number 4 Region: 44-109
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000182
Family I set domains 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017778   Gene: ENSNLEG00000014597   Transcript: ENSNLET00000018666
Sequence length 569
Comment pep:known_by_projection supercontig:Nleu1.0:GL397368.1:3893321:3916245:1 gene:ENSNLEG00000014597 transcript:ENSNLET00000018666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQTSRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCFRIKTTAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKQMIGICVTLTVIIVCSLFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVREISGFSWLGGSSEEQIAMYNALVH
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREAHMPLG
Download sequence
Identical sequences M3ZAB8
ENSNLEP00000017778 ENSNLEP00000017778 XP_012351190.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]