SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017799 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017799
Domain Number 1 Region: 139-221
Classification Level Classification E-value
Superfamily Immunoglobulin 6.15e-33
Family C1 set domains (antibody constant domain-like) 0.00012
Further Details:      
 
Domain Number 2 Region: 22-152
Classification Level Classification E-value
Superfamily Immunoglobulin 4.1e-31
Family V set domains (antibody variable domain-like) 0.0000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017799   Gene: ENSNLEG00000014610   Transcript: ENSNLET00000018687
Sequence length 278
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:1482294:1739618:1 gene:ENSNLEG00000014610 transcript:ENSNLET00000018687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACPGFLWTLVISTCLEFSMAQTVTQSQPEMSVQEAETVTLSCTYDTTESDYYLFWYKQP
PSRQMILIIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDTAMYFCAYRSTQQG
GSEKLVFGKGTKLTVNPYIQNPDPAVYQLRDSKSSDKSICLFTDFDSQINVSQSKDSDVY
ITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNDSIVPADTFFPSPESLCDVKLVEKS
FETDMNLNFQNLSVMGFRILLLKVAGFNLLMTLRLWSS
Download sequence
Identical sequences ENSNLEP00000017799 ENSNLEP00000017799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]