SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017805 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017805
Domain Number 1 Region: 373-537
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.44e-23
Family Toll/Interleukin receptor TIR domain 0.0048
Further Details:      
 
Domain Number 2 Region: 28-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000268
Family I set domains 0.0079
Further Details:      
 
Domain Number 3 Region: 134-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000309
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 229-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000854
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017805   Gene: ENSNLEG00000014624   Transcript: ENSNLET00000018693
Sequence length 575
Comment pep:known_by_projection supercontig:Nleu1.0:GL397368.1:3927030:3979215:1 gene:ENSNLEG00000014624 transcript:ENSNLET00000018693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSLLLCGLSIALPLSVTADGCKDIFTKNEMLSARQPFAFNCTFPPITSGEVSVTWYKNS
SKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVLKGRDSCHRIHVNLTVFEKHWCDT
SISGLPNLSDEYKQILHLGKDGSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLQTRL
SVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNNSIEVQ
LGTTLIVDCNITDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
TFLEVKMEDYGLPFMCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAVSVVYIYNIFK
IDIVLWYRSAFHSTEAIEDGKLYDAYVLYPKPHKESQRHAVDALVLKILPKVLERQCGYK
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPESLGFGLLKNLSEEQIAVYNALIQDG
MKVILIELEKIEDYTVMPESIQYIRQKHGAIRWHGDFTEQSQCVKTKFWKTVRYHMPPRR
CRPSPPVQLPQHTPCYRTAGPKLGSRRKKCTLTTG
Download sequence
Identical sequences G1RX28
ENSNLEP00000017805 ENSNLEP00000017805 XP_003274924.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]