SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017812 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017812
Domain Number 1 Region: 20-115
Classification Level Classification E-value
Superfamily Immunoglobulin 1.89e-21
Family V set domains (antibody variable domain-like) 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017812   Gene: ENSNLEG00000014644   Transcript: ENSNLET00000018700
Sequence length 117
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:1195671:1196341:1 gene:ENSNLEG00000014644 transcript:ENSNLET00000018700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLVPAFQVIFTLGGTRAQSVTQLDSQVPVFEEGPVELRCNYSSSVSVYLFWYVQYPN
QGLQLLLKYTSGPTLVKGINGFEAEFKKSETSFHLRKPSAHISDAAEYFCAVSDTVP
Download sequence
Identical sequences ENSNLEP00000017812 ENSNLEP00000017812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]