SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017813 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017813
Domain Number 1 Region: 369-541
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.24e-29
Family Toll/Interleukin receptor TIR domain 0.00072
Further Details:      
 
Domain Number 2 Region: 26-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000807
Family I set domains 0.037
Further Details:      
 
Domain Number 3 Region: 128-204
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000001
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017813   Gene: ENSNLEG00000014642   Transcript: ENSNLET00000018701
Sequence length 556
Comment pep:known_by_projection supercontig:Nleu1.0:GL397368.1:4067288:4081000:1 gene:ENSNLEG00000014642 transcript:ENSNLET00000018701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWILAILTILMYSTAAKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAEVADSGIYTCIVRSPTFNRTGYANVTIYKKQPDCNVPDYLMYS
TVSGSEKNSKIYCPNIDLYNWTAPLEWFKDCQALQGSRYRAHKSFLVIDNVMTEDAGDYT
CKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIRAPAQNETKEVEIGKKIYQNAVNIAW
KILPYDPLTSLEAPALRIRYYWEPGHSDCSGYICSINVNVLVLKAAMKIPSGYILREILG
SQHPCIYLLYLVSVVIIDFFFLLVDRHSTYCIIAVCSVLLMLINVLVIILKMFWIEATLL
WRDIAKPYKTRNDGKLYDAYIIYPRNYKSGTDGASHVEYFVHQILPDVLENKCGYTLCIY
GRDMLPGEDVVTAVETNIRNSRRHIFILTPQITHSKEFAYEQEVALHCALIQNDAKVILI
EMEALSELDMLQAEALQDSLRHLMKVQGTIKWREDHITNKQSLNSKFWKHVRYQMPVPRK
IPRKASSLTPLAAQKQ
Download sequence
Identical sequences ENSNLEP00000017813 ENSNLEP00000017813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]