SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017815 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017815
Domain Number 1 Region: 26-116
Classification Level Classification E-value
Superfamily Immunoglobulin 5.71e-22
Family V set domains (antibody variable domain-like) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017815   Gene: ENSNLEG00000014645   Transcript: ENSNLET00000018703
Sequence length 137
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:1323474:1325163:1 gene:ENSNLEG00000014645 transcript:ENSNLET00000018703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKNLLAAPLLILWLHLDCVSSVLNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYKW
ETAKSPKALFVMNLNGDEKKKGRINATLNTKEGYSYLYIKGSQPEDSATYLCAFTQCCSG
TCSPYAKVCLGLHCYQH
Download sequence
Identical sequences ENSNLEP00000017815 ENSNLEP00000017815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]