SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017824 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017824
Domain Number 1 Region: 139-247
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-27
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 2 Region: 233-332
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000144
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 3 Region: 33-96
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000324
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017824   Gene: ENSNLEG00000014640   Transcript: ENSNLET00000018713
Sequence length 380
Comment pep:known_by_projection supercontig:Nleu1.0:GL397286.1:10983393:10996920:-1 gene:ENSNLEG00000014640 transcript:ENSNLET00000018713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVCLAIGCLYTFLISTTFGCTSSSDAKIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
NFKECTVEYELKYRNIGSETWTTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQ
SSWAETTYRISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDH
ALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKTIRSSYFTFQLQNIVKPLP
PGYLTFTRESLHEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTTTVENETYTLKTTNE
TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLLKKTLPLFLVPFGFILILVIFVTS
LFLRKPNTYLKMIPEVFCDT
Download sequence
Identical sequences G1RX47
ENSNLEP00000017824 ENSNLEP00000017824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]