SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017837 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017837
Domain Number 1 Region: 364-521
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.53e-30
Family Toll/Interleukin receptor TIR domain 0.00034
Further Details:      
 
Domain Number 2 Region: 220-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000264
Family V set domains (antibody variable domain-like) 0.065
Further Details:      
 
Domain Number 3 Region: 25-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000315
Family I set domains 0.054
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017837
Domain Number - Region: 127-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000268
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017837   Gene: ENSNLEG00000014646   Transcript: ENSNLET00000018727
Sequence length 540
Comment pep:known_by_projection supercontig:Nleu1.0:GL397368.1:4090507:4133275:1 gene:ENSNLEG00000014646 transcript:ENSNLET00000018727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCRELPLTLWVLIFVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQERVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMENYTQKWKLNVIRRNKHNCF
TERQVTSKVVEVKKFLQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGLDPNIHEEKEIRIMTSEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKDMADIPGHVFARGMIVAVLILVAVVCLVTVCVIYRVDLVLFYRH
LTRRDETLTDGKTYDAFVSYLKECQPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVVP
GGAVVDEIHSLIEKSRRLIIVLSKTYMSNEVRYELESGLHEALVERKIKIILIEFTPVTD
FTFLPQSLKLLKSHRVLKWKANKSLSYNSRFWKNLLYLMPAKTVKPGREESEVLPVLSES
Download sequence
Identical sequences ENSNLEP00000017837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]