SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017897 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017897
Domain Number 1 Region: 539-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 2 Region: 98-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 74-131,193-206,492-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000706
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 37-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000131
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017897
Domain Number - Region: 351-392
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00523
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017897   Gene: ENSNLEG00000014710   Transcript: ENSNLET00000018789
Sequence length 584
Comment pep:known_by_projection supercontig:Nleu1.0:GL397299.1:12395501:12461719:1 gene:ENSNLEG00000014710 transcript:ENSNLET00000018789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRY
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLMCNGDQD
CLDGSDEEDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDANYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLMVGVGVSESEDASFLNELNKYNKEKFIFTRIFTKVQTAH
FKMRRDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGTYEYIVVIDKA
KMESLGITSRDIMTCFGGSLGIQYEGTINVGGGLSGDHCERFGGGKTERERKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLHRALDQYLMEFNACRCGPCFNNGVPILKGTSCRCQCRLGRLGPACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTKAC
Download sequence
Identical sequences G1RXC0
ENSNLEP00000017897 XP_003265183.1.23891 ENSNLEP00000017897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]