SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017902 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017902
Domain Number 1 Region: 30-178
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 5.5e-41
Family Multidomain sulfurtransferase (rhodanese) 0.00000989
Further Details:      
 
Domain Number 2 Region: 186-304
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.71e-34
Family Multidomain sulfurtransferase (rhodanese) 0.00000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017902   Gene: ENSNLEG00000014722   Transcript: ENSNLET00000018794
Sequence length 317
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:17011918:17022055:1 gene:ENSNLEG00000014722 transcript:ENSNLET00000018794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPGSRESETRARSPSVGAMTSSQLFRALVSAQWVAEALRVPRAGQPLQLLDASWYLPK
LGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY
DASDQGLYSAPRVWWMFRAFGHRAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDL
AFIKTYEDIKENLESRRFQVVDSRAAGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLTQE
GLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWY
MRARPEDVISEGRGKTH
Download sequence
Identical sequences G1RXC5
XP_003264756.1.23891 ENSNLEP00000017902 ENSNLEP00000017902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]