SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017911 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017911
Domain Number 1 Region: 487-524
Classification Level Classification E-value
Superfamily WW domain 0.000000114
Family WW domain 0.0042
Further Details:      
 
Domain Number 2 Region: 108-144
Classification Level Classification E-value
Superfamily WW domain 0.000000188
Family WW domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017911
Domain Number - Region: 698-761
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.00798
Family Adhesin YadA, collagen-binding domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017911   Gene: ENSNLEG00000014720   Transcript: ENSNLET00000018804
Sequence length 913
Comment pep:known_by_projection supercontig:Nleu1.0:GL397449.1:1851955:1893274:-1 gene:ENSNLEG00000014720 transcript:ENSNLET00000018804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGLCLLGAYADSDDDDNDVSEKPAQSKETNGNQSTDIDSTLANFLAEIDAITAPQPATPV
GASAPPPTPPRPEPKEVATSTLSSSTSNGTDSTQTSGWQYDTQCSLAGVGIEMGDWQEVW
DENTGCYYYWNTQTNEVTWELPQYLATQVQGLQHYQPSSVPGAETSFVVNTDIYSKEKTI
SVSSSKSGPVIAKREVKKEVNEGIQALSNSEEEKKGVAASLLAPLLPEGIKEEEERWRRK
VICKEEPVSEVKETSTTVEEATTIVKPQEIMLDNIEDPSQEDLCSVVQSGESEEEEEQDT
LELELVLERKKAELRALEEGDGSVSGSSPRSDISQPASQDGMRRLMSKRGKWKMFVRATS
PESTSRSSSKTGRDTPENGETAIGAENSEKIDENSDKEVEVEESPEKIKVQTTPKVEEEQ
DLKFQIGELANTLTSKFEFLGINRQSISNFHVLLLQTETRIADWREGALNGNYLKRKLQD
AAEQLKQYEINATPKGWSCHWDRDHRRYFYVNEQSGESQWEFPDGEEEEEESQAQESRDE
TLAKQTLKDKTGTDSNSTESSETSTGSLCKESFSGQVSSSSLMPLTPFWTLLQSNVPVLQ
PPLPLEMPPPPPPPPESPPPPPPPPPPVEDGEIQEVEMEDEGSEEPPAPGTEEDTPLKPS
AQTTVVTSQSSVDSTISSSSSTKGIKRKATEISTAVVQRSATIGSSPVLYSQSAIATGHQ
AAGIGNQATGIGHQTIPVSHPAAGMGHQARGMSLQSNYLGLAAAPAIMSYAECSVPIGAT
APSLQPVQARGAVPTTAIIEPPPPPPPPPPPPPPAPKMPPPEKTKKGKKDKAKKSKTKMP
SLVKKWQSIQRELDEEDNSSSSEEDRESTAQKRIEEWKQQQLVSGMAERNANFEALPEDW
RARLKRRKMAPNT
Download sequence
Identical sequences ENSNLEP00000017911 ENSNLEP00000017911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]