SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017932 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017932
Domain Number 1 Region: 32-130
Classification Level Classification E-value
Superfamily Fibronectin type III 1.9e-31
Family Fibronectin type III 0.00000918
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017932
Domain Number - Region: 128-195
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000926
Family Fibronectin type III 0.0000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017932   Gene: ENSNLEG00000014746   Transcript: ENSNLET00000018825
Sequence length 530
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:17123551:17145104:-1 gene:ENSNLEG00000014746 transcript:ENSNLET00000018825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALSWRLPLLILLLPLATPWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
VHAWPDRRTWVEACGEAPNIPGSSRSFTPALLPLQSQKLTAVDIVTLRVMCREGVRWRMM
AIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWE
VRMWPSPHLPWFLLPVLTQKARRQAAAQPHGLSEAREATPPSKPICSTSVRASLGKDTIP
WLGHLLVGLSGTFGFIVLVYLLINCGNTGPWLKKVLKCHTPDPSKFFSQLSSEHGGDVQK
WLSSPFPSSSFSPGGLAPEISPLEVLERDKATQLLLQQDKVPEPASLSSNHSLTSCFTNQ
GYFFFHLPDAFEIEACQVYFTYDPCAEEDPDEGGAGAPTGSSPQPLQPLSGEDDAYCTFP
SRDDLLLFSPSLLGGPSPPSTAPGDSGAGEERLPASLQERVPRDWDPQPLGPPTPGVPDL
VDFQPPPELVLREAVEEAPDLGPREGVSFPWSRPPGQGEFRALNARLPLN
Download sequence
Identical sequences ENSNLEP00000017932 ENSNLEP00000017932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]