SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017933 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017933
Domain Number 1 Region: 41-142
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.7e-18
Family Splicing factor U2AF subunits 0.00000597
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017933
Domain Number - Region: 147-170
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000484
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017933   Gene: ENSNLEG00000014737   Transcript: ENSNLET00000018826
Sequence length 237
Comment pep:novel supercontig:Nleu1.0:GL397505.1:1143235:1153402:-1 gene:ENSNLEG00000014737 transcript:ENSNLET00000018826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLREKNKRLAICKQIVSLQLSNICTAASRIPLFIFFSPQTILIQNIYRNPQNSAQTAD
GSHCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMNVCDNLGDHLVGNVYVKFRREEDA
EKAVIDLNNRWFNGQPIHAELSPVTDFREACCRQYEMGECTRGGFCNFMHLKPISRELRR
ELYGRRRKKHRSRSRSRERRSRSRDRGRGGGGGGGGGGGGRERDRRRSRDRERSGRF
Download sequence
Identical sequences XP_012357288.1.23891 ENSNLEP00000017933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]