SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017942 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000017942
Domain Number - Region: 2-22
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000294
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017942   Gene: ENSNLEG00000014743   Transcript: ENSNLET00000018835
Sequence length 423
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:2922177:2940288:1 gene:ENSNLEG00000014743 transcript:ENSNLET00000018835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTTSQRYSSVIQP
SSFSKSTPWGGSRDQEKPSFGSFDSGASTNRKEGFGLSENPFASLNPDEQKDEKKLLEGI
VKDMEVWESSGQWMFSVYSPVKKKPNISGFTDISPEELRLEYHNFLTSNNLQSYLNSVQR
LINQWRNRVNELKNLNISTKVALLSDVKDGVNQAAPAFGFGSSQAATFVSPSFPVNNSSS
DNAQNFSFKTNSGFAAASSGSPAGFGSSPAFGAAASTSSGISTSAPAFGFGKPEVTSAAS
FSFKSPAASSFGSPGFSGLPTSLATGPVRAPVAPAFGGGSSVAGFGSPGSHSHTAFSKPS
SDTFGNSSISSSLSASSSIIATDNVLFTPRDKLTVEELEQFQSKKFTLGKIPLKPPPLEL
LNI
Download sequence
Identical sequences A0A2I3HWY3
ENSNLEP00000017942 ENSNLEP00000017942 XP_003270443.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]