SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017951 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017951
Domain Number 1 Region: 36-525
Classification Level Classification E-value
Superfamily Sema domain 4.58e-178
Family Sema domain 0.0000000000798
Further Details:      
 
Domain Number 2 Region: 521-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000262
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 588-669
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000304
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017951   Gene: ENSNLEG00000014747   Transcript: ENSNLET00000018845
Sequence length 759
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:11660722:11849824:-1 gene:ENSNLEG00000014747 transcript:ENSNLET00000018845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTCISEEMAFRTICVLVGVFICSVCVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPL
DYRILLMDEDQDRIYVGSKDHILSLNINNISQEPLSVFWPASTIKVEECKMAGKDPTHGC
GNFVRVIQTFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNV
NTVSVMINEELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDG
TDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSV
TDEDGPETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGP
FAHKEGPNHQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIY
PIHKRPLIVRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNSSVSGEL
ILEELEVFKNHAPITTMKISSKKQQLYVSSNEGISQVSLHRCHIYGTACADCCLARDPYC
AWDGHSCSRFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLEC
APKSPQASIKWLLQKDKDRRKEVKLNERIIATSQGLLIRSVQGSDQGLYHCIATENSFKQ
TIAKINFKVLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDT
RQQHPQGDESQKMRGDYGKLKALINSRKSRNRRNQLPES
Download sequence
Identical sequences ENSNLEP00000017951 XP_003252237.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]