SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017955 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017955
Domain Number 1 Region: 22-69,103-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000188
Family V set domains (antibody variable domain-like) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017955   Gene: ENSNLEG00000014769   Transcript: ENSNLET00000018849
Sequence length 446
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:17186302:17240970:-1 gene:ENSNLEG00000014769 transcript:ENSNLET00000018849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKS
YCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGR
EITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFA
VEIMPEWVFVGLVLLGVFLFFVLVGICWCQCCPHSCCCYVRCPCCPDSCCCPQALYEAGK
AAKAGYPPSVSGVPGPYSIPSVPLGGAPSSGMLMDKPHPPPLAPSDSTGGSHSVRKGYRI
QADKERDSMKVLYYVEKELAQFDPARRMRGRYNNTISELSSLHEEDSNFRQSFHQMRSKQ
FPVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHSQPRSKSEMLSRKNFAT
GVPAVSMDELAAFADSYGQRPRRADG
Download sequence
Identical sequences ENSNLEP00000017955 ENSNLEP00000017955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]