SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017966 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017966
Domain Number 1 Region: 997-1281
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.4e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000126
Further Details:      
 
Domain Number 2 Region: 519-683
Classification Level Classification E-value
Superfamily Fibronectin type III 3.45e-16
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 3 Region: 103-251
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000555
Family Fibronectin type III 0.0048
Further Details:      
 
Domain Number 4 Region: 306-415
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000023
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number 5 Region: 716-847
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000482
Family Fibronectin type III 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017966   Gene: ENSNLEG00000014775   Transcript: ENSNLET00000018860
Sequence length 1318
Comment pep:known_by_projection supercontig:Nleu1.0:GL397449.1:2227720:2298303:1 gene:ENSNLEG00000014775 transcript:ENSNLET00000018860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEFVLPLLMVVFRLSQILCAGGTPSPIPDPSVATVATGENGVTQISSTAESFHKQNGTGT
PQVETNTNEDGENSGANDSLITPEQGSNGTDGASQKTPSGAGPSPVFDIKAVSISPTSVI
LTWKSNDTAASEYKCVVKNEMENEKTITVVHQLWCNITGLRPATSYVFSITPGIGNETWG
DPRVIKVITEPIPVSDLRVSLTGVRKATLSWGNGNGTASCRLLLESHEELTQDSRLQVNI
SGLKPGVQYSINPYLLQSNKTKGDPLGTEGGLDASNTERSRAGSPTAPVHDESLLGPVDP
SSSQQSQDTEVLLVGLEPGTRYNATVYSQAANGTEGEPQAIEFRTNAIQVFDVTAVNISA
TSLTLIWKVSDNESSSNYTYKIHVVGETDSTNLTVREPRAVIPELRSSTFYNITVHPVLG
DMKGTPGFLQVHTPPVPVSDFRVTVVSTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFPGTKYCFEIVPKGPNGTEGASRTVCNRTVPSAVFDIHVVYVTTTEMRLE
WKSPDGASECVYHLVIESKHGSNHTSTYDKAVTLQGLIPGTLYNITISPEVDHVRGDPSS
TAQYTRPSDVSNIDVSTNTTAATLSWQNFDDASPTYSYCLLVEKVGNSSNATQVVTDTGI
TEATVAELIPGSSYTVEIFAQVGDGIKSLEPGWKSFCTDPASVASFDCEVVPKEPALVLK
WTCPPGANAGFELEVSSGAWDNATHLESCFSENGTECRTEVTHLNFSTSYNISITAVSCG
KMAAPAQNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGFEASHGPIKAYAVILTTGEA
GHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSEVLKYEIDVGNESTTLGYYN
GKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRYSDAVSLPQDPGVICGAVFG
CIFGALVIVTVGGFVFWRKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNC
GFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQSHSTDDYINANY
MPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQ
DYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDLLINFR
YLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLRMHRP
LMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA
Download sequence
Identical sequences ENSNLEP00000017966 ENSNLEP00000017966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]