SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000017975 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000017975
Domain Number 1 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-17
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 2 Region: 398-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 139-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 35-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000432
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000017975
Domain Number - Region: 328-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 356-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00131
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000017975   Gene: ENSNLEG00000014773   Transcript: ENSNLET00000018870
Sequence length 713
Comment pep:known_by_projection supercontig:Nleu1.0:GL397280.1:2040960:2047411:1 gene:ENSNLEG00000014773 transcript:ENSNLET00000018870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSATLLLLLLGGALAHPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWL
ILGSKEQTVTIRFQKLHLACGSEHLTLHSPLQPLISLCEAPPSPLQLPGGNVTITYSYAG
ARAPIGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGIDACGDGSDEAGCSSDLFP
GLTPRPVPSLPCNLTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALD
LGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNA
TYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGH
FPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDG
QPDCADGSDEWDCSYVLPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPL
SRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMSPGG
GPGARRRQRGRLMRRLVRRLRRWGLLPRTNTPARASEARSQVTPSAAPLEALDDGTGPAR
EGGAVGGQDGEQAPPLPIKAPLPSASTSPAPTTVPEAPGPLPSLPLEPSLLSGVVQALRG
RLLPSLGPPGPTRSPPGPHTAVLAPEDEDDVLLVPLAEPGVWVAEAEDEPLLT
Download sequence
Identical sequences G1RXJ8
XP_003260642.1.23891 ENSNLEP00000017975 ENSNLEP00000017975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]