SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018021 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018021
Domain Number 1 Region: 127-238
Classification Level Classification E-value
Superfamily Fibronectin type III 1.52e-22
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 224-333
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000323
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018021   Gene: ENSNLEG00000014814   Transcript: ENSNLET00000018917
Sequence length 425
Comment pep:known_by_projection supercontig:Nleu1.0:GL397286.1:14454564:14528273:1 gene:ENSNLEG00000014814 transcript:ENSNLET00000018917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWPARLCGLWALLLCAGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASPNC
SLWYFSHFGDKQDKKIAPETRRSKEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPE
GDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCEKIYREGQY
FGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDD
LYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCQNPEFERNVENTSCFMVPGV
LPDTLNTVRIRVKTNKLCFEDDKLWSNWSQEMSIGKKRNSTLYITMLLIVPVIVAGAIIV
LLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDICEKQTKEETDSVVLIENP
KKASQ
Download sequence
Identical sequences G1RXP4
ENSNLEP00000018021 ENSNLEP00000018021 XP_003262289.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]